PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G202500.1
Common NameB456_007G202500, LOC105803794
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ZF-HD
Protein Properties Length: 325aa    MW: 35849 Da    PI: 8.5812
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G202500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.92.4e-33115169459
         ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                         +rYkeClkNhAa +Ggh+vDGCgEfmps geegt++alkCaAC+CHR+FHR+e + 
  Gorai.007G202500.1 115 IRYKECLKNHAAGMGGHVVDGCGEFMPS-GEEGTPEALKCAACECHRSFHRKEING 169
                         79*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-21113168IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-30115167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-31116167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.313117166IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466899.23E-20244318IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-29245318IPR009057Homeodomain-like
PROSITE profilePS500718.73255319IPR001356Homeobox domain
TIGRFAMsTIGR015658.8E-28257314IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MELRGQDNKE MGMPSSFSYK NQLNKDSYSS APVNLATGER RRDRTVHGDP NLPQTLDDPL  60
SVPNPRRDSD PDPVSASTAT TGEIAAAADS RSPPTPEPQP VAGPTSATIS FSPLIRYKEC  120
LKNHAAGMGG HVVDGCGEFM PSGEEGTPEA LKCAACECHR SFHRKEINGE SQYAPSSYYY  180
TNNNNTRRNA VRPPPRATPL HHQRFSLGLS ASPPAMSVAP LMMSFGGGGQ AESSSEDLNM  240
FHFSEGGQQP SHPHSSKKRF RTKFSQEQKN KMMEFADKLG WKIQKQDDEQ VQQFCDQVGV  300
KRQVLKVWMH NNKQAMKRTN VRDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-232563151675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6149440.0JX614944.1 Gossypium hirsutum clone NBRI_GE58680 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491647.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW73e-71ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0D2PCF50.0A0A0D2PCF5_G
STRINGPOPTR_0005s12420.12e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.13e-70homeobox protein 24
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]